Description

A beta-sheet from 1A0S.pdb containing amino acids 334 ADTWRIASYGTTPLSENWSVAPAMLAQRSKDRYADGDSYQWATFNLRLIQAINQ387, chain P, visualized in different representations. Stabilizing H-bonds between the peptide backbone atoms as well as sidechains are highlighted. I made this to use it for teaching Biochemistry and Structural Biology. Models respond to the following Biomolecular visualization learning goals (BioMolViz; DOI:10.1002/bmb.20991) AR2.02 Students will describe the atoms that are represented in different renderings. (novice) The model shows the color capabilities of 3DP-Jmol (https://github.com/mariusmihasan/3DP-Jmol (https://github.com/mariusmihasan/3DP-Jmol)), a script for automatically converting structural data into printable files.